Independently batch-tested research materials
FOXO4-DRI
Product Name: FOXO4-DRI (FOXO4 D-Retro-Inverso) Chemical Information: Molecular Formula: C 228 H 388 N 86 O 64 Molecular Weight: ~5358 g/mol Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids; retro-inverso) Structure Class: Synthetic peptide (D-retro-inverso configuration) Molecular Structure: Product Description: FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research. Research Applications: FOXO4-DRI is utilized in controlled laboratory research settings for applications such as: Evaluation of D-retro-inverso peptide behavior in stability and interaction assays Investigation of peptide–protein binding interactions in defined assay systems Comparative analysis of L- and D-configured peptide structures under controlled conditions Development of in vitro assay systems for studying peptide interaction characteristics Storage and Handling: Store lyophilized powder at −20 °C until use Once reconstituted, store at 2–8 °C and use promptly Maintain aseptic technique during handling Product Specifications: Purity: ≥99% (HPLC/LC-MS Verified) Appearance: Lyophilized white powder Solubility: Soluble in suitable laboratory agents Compliance Notice: FOXO4-DRI is FOR RESEARCH USE ONLY . It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.
Research areas: Oncology & Cell Fate, Regeneration & Longevity
Available research formats
- 5mg — $99.00 USD
- 10mg — $179.00 USD
Search the Certificate of Analysis library for batch-specific test documentation.