Pure Health Peptides

Independently batch-tested research materials

GLP-1 (C)

GLP-1 (C) research vials product

Research Area: Metabolics Chemical Information: Molecular Formula: C 194 H 312 N 54 O 59 S 2 Molecular Weight: 4409.01 g/mol Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP *) *) Note: Where “X” denotes a non-standard or modified N-terminal residue (γ-glutamyl-linked moiety) as defined by the compound structure. Molecular Structure: Product Description: This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use. Product Designation Note: This product is identified using an internal designation for cataloging and differentiation purposes. It is not marketed, labeled, or represented as any approved pharmaceutical or therapeutic compound.. Research Applications: In laboratory research settings, this peptide analog is utilized in controlled experimental systems to support investigation of: Peptide interaction characterization in defined assay systems Receptor binding interaction modeling in controlled experimental environments Structure–property relationship analysis Stability, degradation, and binding behavior under experimental conditions Comparative evaluation of peptide analog modifications These research activities are conducted in non-clinical, non-therapeutic contexts. Storage and Handling: Store the lyophilized powder at -20°C. Once reconstituted, store at 2-8°C and use promptly. Maintain aseptic handling practices to ensure product quality and sterility. Product Specifications: Purity: ≥99% (HPLC Certified) Appearance: Lyophilized white powder Solubility: Soluble in suitable laboratory agents Compliance Notice: This compound is FOR RESEARCH USE ONLY . It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.

Research areas: Metabolic

Available research formats

  • 10mg — $115.00 USD

Search the Certificate of Analysis library for batch-specific test documentation.

Related research materials