Pure Health Peptides

Independently batch-tested research materials

Tesmorelin

Tesmorelin research vials product

Product Name: Tesmorelin (Growth Hormone-Releasing Hormone Analog) Chemical Information: Molecular Formula: C 223 H 370 N 72 O 69 S Molecular Weight: 5195.9 g/mol Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Structure: Product Description: Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) and is commonly utilized in biochemical and molecular research involving peptide–receptor interactions and signaling pathway analysis. In controlled laboratory settings, it is studied for its interaction with growth hormone-releasing hormone receptors (GHRH-R) and its role in intracellular signaling mechanisms within endocrine research models under defined in vitro conditions. This material is supplied in lyophilized powder form and is intended strictly for in vitro research and analytical applications. Research Applications: Tesmorelin is utilized in controlled research environments to support investigation of: Growth hormone-releasing hormone receptor (GHRH-R) binding and signaling pathway analysis in isolated cell-based or cell-free in vitro assay systems Peptide–receptor interaction dynamics in endocrine signaling models Intracellular signaling cascade evaluation associated with peptide ligands Structure-function relationships of GHRH-derived peptide analogs Stability, degradation, and analytical profiling in assay-based systems All research applications are conducted in non-human, non-clinical experimental settings . Storage and Handling: Store lyophilized material at −20°C (−4°F) After reconstitution, store at 2–8°C (36–46°F) and use promptly Avoid repeated freeze-thaw cycles Maintain aseptic laboratory handling procedures Product Specifications: Purity: ≥99% (HPLC Certified) Appearance: Lyophilized white powder Solubility: Soluble in suitable laboratory agents Compliance Notice: Tesmorelin is FOR RESEARCH USE ONLY . It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.

Research areas: Growth & Repair

Available research formats

  • 5mg — $47.00 USD
  • 10mg — $73.00 USD

Search the Certificate of Analysis library for batch-specific test documentation.

Related research materials